Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Insect Hypodermin-A protein

This Insect Hypodermin-A protein spans the amino acid sequence from region 31-256aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HA

UniProt

P35587

Expression Region

31-256aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Hypoderma lineatum (Early cattle grub) (Common cattle grub)

Field of Research

Epigenetics

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

28.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IVGGVESKIEDFPWQISLQRDGRHYCGGSIYSKNVIITAAHCLRNVVAEELRVRVGSSYWEHGGSLRNISKFQIHESYVEPTKEYDVALLKLDSDLSFNSTIKAIELTNEIPPEYADAIVSGWGETLVPPPGIPDQLRSVDVKIIHREKCASRNFGYGSNIKASMICAYAIGKDSCQGDSGGPLVVNNLLVGVVSWGIDCARPSYPGVYVDVSHVRSWIVSNAESI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCDH12 Antibody
GWB-MQ713B 50 µg

PCDH12 Antibody

Sign In for Pricing
View Details
MAPE (C-term) Rabbit pAb
E2615867 100 µL

MAPE (C-term) Rabbit pAb

Sign In for Pricing
View Details
COL1A2 (H-9) Alexa Fluor® 546
sc-376350 AF546 200 µg/mL

COL1A2 (H-9) Alexa Fluor® 546

Sign In for Pricing
View Details
Recombinant human CIB2 protein
ATGP0909-100 100 µg

Recombinant human CIB2 protein

Sign In for Pricing
View Details
Rabbit Polyclonal Lipin 1 Antibody
NBP2-19370 0.1 mL

Rabbit Polyclonal Lipin 1 Antibody

Sign In for Pricing
View Details
AP1 Antibody
orb784031 2 mg

AP1 Antibody

Sign In for Pricing
View Details