Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Ts1 protein

This Animal Ts1 protein spans the amino acid sequence from region 21-81aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PT-Mice-Ins-beta NaTx6.1 (Tityustoxin VII) (Ts VII) (Ts7) (TsTX-VII) (Toxin II-11) (Toxin III-10) (Toxin T2-IV) (Toxin gamma) (TsTX-I)

UniProt

P15226

Expression Region

21-81aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Tityus serrulatus (Brazilian scorpion)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEGYLMDHEGCKLSCFIRPSGYCGRECGIKKGSSGYCAWPACYCYGLPNWVKVWDRATNKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

gAcrp30 protein
30R-AG002 25 ug

gAcrp30 protein

Sign In for Pricing
View Details
Orlistat Impurity 31
RM-O121931-01 10 mg

Orlistat Impurity 31

Sign In for Pricing
View Details
Orlistat Impurity 31
RM-O121931-02 25 mg

Orlistat Impurity 31

Sign In for Pricing
View Details
Orlistat Impurity 31
RM-O121931-03 50 mg

Orlistat Impurity 31

Sign In for Pricing
View Details
Orlistat Impurity 31
RM-O121931-04 100 mg

Orlistat Impurity 31

Sign In for Pricing
View Details
St18 sgRNA CRISPR Lentivector (Rat) (Target 3)
K7248504 1.0 µg DNA

St18 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details