Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli cfaB protein

This E. coli cfaB protein spans the amino acid sequence from region 24-170aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CFA/I antigen (CFA/I pilin) (Colonization factor antigen I subunit B) (cfaB)

UniProt

P0CK93

Expression Region

24-170aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VEKNITVTASVDPAIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hibifolin
MBS5760465 Inquire

Hibifolin

Sign In for Pricing
View Details
SFRP3 (Secreted Frizzled Related Protein 3, sFRP-3, SRFP3, Frizzled-related Protein 1, FIZ, FRE, Frezzled, Fritz, FRP, FRZB, FRZB-PEN, Frzb1, FrzB-1, hFIZ, OS1) APC
MBS6393905-01 0.1 mL

SFRP3 (Secreted Frizzled Related Protein 3, sFRP-3, SRFP3, Frizzled-related Protein 1, FIZ, FRE, Frezzled, Fritz, FRP, FRZB, FRZB-PEN, Frzb1, FrzB-1, hFIZ, OS1) APC

Sign In for Pricing
View Details
SFRP3 (Secreted Frizzled Related Protein 3, sFRP-3, SRFP3, Frizzled-related Protein 1, FIZ, FRE, Frezzled, Fritz, FRP, FRZB, FRZB-PEN, Frzb1, FrzB-1, hFIZ, OS1) APC
MBS6393905-02 5x 0.1 mL

SFRP3 (Secreted Frizzled Related Protein 3, sFRP-3, SRFP3, Frizzled-related Protein 1, FIZ, FRE, Frezzled, Fritz, FRP, FRZB, FRZB-PEN, Frzb1, FrzB-1, hFIZ, OS1) APC

Sign In for Pricing
View Details
Recombinant Mouse Ephrin B3/ EFNB3 Protein, His, Yeast-10ug
QP5967-ye-10ug 10ug

Recombinant Mouse Ephrin B3/ EFNB3 Protein, His, Yeast-10ug

Sign In for Pricing
View Details
OR7E12P 3'UTR GFP Stable Cell Line
TU066762 1.0 mL

OR7E12P 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Monoclonal CDO Antibody (076) [Alexa Fluor 647]
NBP2-90033AF647 0.1 mL

Rabbit Monoclonal CDO Antibody (076) [Alexa Fluor 647]

Sign In for Pricing
View Details