Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli cfaB protein

This E. coli cfaB protein spans the amino acid sequence from region 24-170aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CFA/I antigen (CFA/I pilin) (Colonization factor antigen I subunit B) (cfaB)

UniProt

P0CK93

Expression Region

24-170aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VEKNITVTASVDPAIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

DHFR Rabbit Polyclonal Antibody
TA366145 100 µL

DHFR Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
N-Nitroso Ectoine
CS-O-46165 1 Each

N-Nitroso Ectoine

Sign In for Pricing
View Details
Goat Polyclonal FKBP52/FKBP4 Antibody
NBP1-18845 0.1 mg

Goat Polyclonal FKBP52/FKBP4 Antibody

Sign In for Pricing
View Details
Bovine Thioredoxin Binding Protein 2 ELISA Kit
MBS739763-01 48 Well

Bovine Thioredoxin Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details
Bovine Thioredoxin Binding Protein 2 ELISA Kit
MBS739763-02 96 Well

Bovine Thioredoxin Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details
Bovine Thioredoxin Binding Protein 2 ELISA Kit
MBS739763-03 5x 96 Well

Bovine Thioredoxin Binding Protein 2 ELISA Kit

Sign In for Pricing
View Details