Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

E. coli cfaB protein

This E. coli cfaB protein spans the amino acid sequence from region 24-170aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CFA/I antigen (CFA/I pilin) (Colonization factor antigen I subunit B) (cfaB)

UniProt

P0CK93

Expression Region

24-170aa

Tag

N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Escherichia coli

Field of Research

Infectious Disease & Virology; Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VEKNITVTASVDPAIDLLQADGNALPSAVKLAYSPASKTFESYRVMTQVHTNDATKKVIVKLADTPQLTDVLNSTVQMPISVSWGGQVLSTTAKEFEAAALGYSASGVNGVSSSQELVISAAPKTAGTAPTAGNYSGVVSLVMTLGS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Peptide YY ELISA Kit (Colorimetric)
NBP2-62166 1 Kit

Human Peptide YY ELISA Kit (Colorimetric)

Sign In for Pricing
View Details
BB5.1 Cell Line (Hybridoma)
116057L 0.5 mg

BB5.1 Cell Line (Hybridoma)

Sign In for Pricing
View Details
Human GJB6 shRNA Plasmid
abx957364-01 150 µg

Human GJB6 shRNA Plasmid

Sign In for Pricing
View Details
Human GJB6 shRNA Plasmid
abx957364-02 300 µg

Human GJB6 shRNA Plasmid

Sign In for Pricing
View Details
ZytoLight® SPEC FGFR2 Dual Color Break Apart Probe
ZTV-Z-2169-200 200 µL

ZytoLight® SPEC FGFR2 Dual Color Break Apart Probe

Sign In for Pricing
View Details
Fn3k ORF Vector (Mouse) (pORF)
20710014 1.0 µg DNA

Fn3k ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details