Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RNASEL protein

This Human RNASEL protein spans the amino acid sequence from region 330-741aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ribonuclease 4Ribonuclease L , RNase L

UniProt

Q05823

Expression Region

330-741aa

Tag

N-terminal 6xHis-SUMO-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

63.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

HPPAEDWKPQSSHWGAALKDLHRIYRPMIGKLKFFIDEKYKIADTSEGGIYLGFYEKQEVAVKTFCEGSPRAQREVSCLQSSRENSHLVTFYGSESHRGHLFVCVTLCEQTLEACLDVHRGEDVENEEDEFARNVLSSIFKAVQELHLSCGYTHQDLQPQNILIDSKKAAHLADFDKSIKWAGDPQEVKRDLEDLGRLVLYVVKKGSISFEDLKAQSNEEVVQLSPDEETKDLIHRLFHPGEHVRDCLSDLLGHPFFWTWESRYRTLRNVGNESDIKTRKSESEILRLLQPGPSEHSKSFDKWTTKINECVMKKMNKFYEKRGNFYQNTVGDLLKFIRNLGEHIDEEKHKKMKLKIGDPSLYFQKTFPDLVIYVYTKLQNTEYRKHFPQTHSPNKPQCDGAGGASGLASPGC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human 4-1BB/TNFRSF9 MAb (Clone 145501)
MAB838-SP 25 µg

Human 4-1BB/TNFRSF9 MAb (Clone 145501)

Sign In for Pricing
View Details
Anti-CD34 / Mucosialin Monoclonal Antibody (Clone:QBEnd-10) -PE Conjugated
30-2265-100 100 Tests

Anti-CD34 / Mucosialin Monoclonal Antibody (Clone:QBEnd-10) -PE Conjugated

Sign In for Pricing
View Details
R Antibody
MBS9016218 Inquire

R Antibody

Sign In for Pricing
View Details
POLA2 Conjugated Antibody
MBS9453879-01 0.1 mL (AF350)

POLA2 Conjugated Antibody

Sign In for Pricing
View Details
POLA2 Conjugated Antibody
MBS9453879-02 0.1 mL (AF405)

POLA2 Conjugated Antibody

Sign In for Pricing
View Details
POLA2 Conjugated Antibody
MBS9453879-03 0.1 mL (AF488)

POLA2 Conjugated Antibody

Sign In for Pricing
View Details