Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Genome poly protein

This Virus Genome poly protein spans the amino acid sequence from region 302-400aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A075TBC5

Expression Region

302-400aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Tick-borne encephalitis virus

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

26.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GLTYTMCDKTKFTWKRIPTDSGHDTVVMEVAFSGTKPCRIPVRAVAHGSPDVNVAMLITPNPTIETNGGGFIEMQLPPGDNIIYVGELSHQWFQKGSSI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human Melanocortin receptor 3 (MC3R)
orb2658878-01 20 µg

Recombinant Human Melanocortin receptor 3 (MC3R)

Sign In for Pricing
View Details
Recombinant Human Melanocortin receptor 3 (MC3R)
orb2658878-02 100 µg

Recombinant Human Melanocortin receptor 3 (MC3R)

Sign In for Pricing
View Details
Prokineticin 2 Isoform 2 (human)
H-7342.0100 0.1mg

Prokineticin 2 Isoform 2 (human)

Sign In for Pricing
View Details
SLC7A2 Rabbit Polyclonal Antibody (BF555)
orb2458072 100 µL

SLC7A2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details
Ifitm2 ORF Vector (Rat) (pORF)
ORF068510 1.0 µg DNA

Ifitm2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
Clostridium sp. (HRP)
C5853-25C 1 mL

Clostridium sp. (HRP)

Sign In for Pricing
View Details