Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT-CO1 protein

This Human MT-CO1 protein spans the amino acid sequence from region 474-513aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide I (COI) (COXI) (MTCO1)

UniProt

P00395

Expression Region

474-513aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal SAR1B Antibody (1C7) [DyLight 594]
NBP2-22566DL594 0.1 mL

Mouse Monoclonal SAR1B Antibody (1C7) [DyLight 594]

Sign In for Pricing
View Details
Fractalkine (Neurotactin) (FITC) discontinued
F6070-16A-FITC 100 µL

Fractalkine (Neurotactin) (FITC) discontinued

Sign In for Pricing
View Details
Thioredoxin 2 Rabbit Polyclonal Antibody (Cy7)
orb1043701 100 µL

Thioredoxin 2 Rabbit Polyclonal Antibody (Cy7)

Sign In for Pricing
View Details
Vmn2r30 (NM_009490) Mouse Tagged ORF Clone
MG214047 10 µg

Vmn2r30 (NM_009490) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
OSCAR Antibody - middle region
ARP88901_P050-25UL 25 µL

OSCAR Antibody - middle region

Sign In for Pricing
View Details
ABCB6 Rabbit Polyclonal Antibody (Biotin)
orb2577433 100 µg

ABCB6 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details