Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT-CO1 protein

This Human MT-CO1 protein spans the amino acid sequence from region 474-513aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide I (COI) (COXI) (MTCO1)

UniProt

P00395

Expression Region

474-513aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Trt-Gln(Trt)-OH · DEA
E-3655.0005 5.0g

Trt-Gln(Trt)-OH · DEA

Sign In for Pricing
View Details
LRIG3 ELISA Kit (Human) (OKBB01033)
OKBB01033 96 Well

LRIG3 ELISA Kit (Human) (OKBB01033)

Sign In for Pricing
View Details
Anapc10 3'UTR Lenti-reporter-Luc Vector
11873084 1.0 µg

Anapc10 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Rabbit RPL7 IHC Antibody
orb1518044-01 10 µL

Rabbit RPL7 IHC Antibody

Sign In for Pricing
View Details
Rabbit RPL7 IHC Antibody
orb1518044-02 100 µL

Rabbit RPL7 IHC Antibody

Sign In for Pricing
View Details
Ovalbumin Antibody HRP Conjugated
orb1543704 100 µL

Ovalbumin Antibody HRP Conjugated

Sign In for Pricing
View Details