Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MT-CO1 protein

This Human MT-CO1 protein spans the amino acid sequence from region 474-513aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide I (COI) (COXI) (MTCO1)

UniProt

P00395

Expression Region

474-513aa

Tag

N-terminal 6xHis-GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cemiplimab (PDCD1/PD1/CD279) - Research Grade Biosimilar Antibody
orb1237793 0.1 mg

Cemiplimab (PDCD1/PD1/CD279) - Research Grade Biosimilar Antibody

Sign In for Pricing
View Details
Olr12 sgRNA CRISPR Lentivector set (Rat)
K7352201 3x 1.0 µg

Olr12 sgRNA CRISPR Lentivector set (Rat)

Sign In for Pricing
View Details
Prepro-Spexin (36-58) (Human) - FAM Labeled Purified IgG
FG-G-023-82A 100 µL

Prepro-Spexin (36-58) (Human) - FAM Labeled Purified IgG

Sign In for Pricing
View Details
CD300LB Antibody; FITC conjugated
MBS7001689-01 0.05 mg

CD300LB Antibody; FITC conjugated

Sign In for Pricing
View Details
CD300LB Antibody; FITC conjugated
MBS7001689-02 0.1 mg

CD300LB Antibody; FITC conjugated

Sign In for Pricing
View Details
CD300LB Antibody; FITC conjugated
MBS7001689-03 5x 0.1 mg

CD300LB Antibody; FITC conjugated

Sign In for Pricing
View Details