Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IRF1 protein

This Human IRF1 protein spans the amino acid sequence from region 1-325aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

IRF-1

UniProt

P10914

Expression Region

1-325aa

Tag

N-terminal 10xHis-HA-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPITRMRMRPWLEMQINSNQIPGLIWINKEEMIFQIPWKHAAKHGWDINKDACLFRSWAIHTGRYKAGEKEPDPKTWKANFRCAMNSLPDIEEVKDQSRNKGSSAVRVYRMLPPLTKNQRKERKSKSSRDAKSKAKRKSCGDSSPDTFSDGLSSSTLPDDHSSYTVPGYMQDLEVEQALTPALSPCAVSSTLPDWHIPVEVVPDSTSDLYNFQVSPMPSTSEATTDEDEEGKLPEDIMKLLEQSEWQPTNVDGKGYLLNEPGVQPTSVYGDFSCKEEPEIDSPGGDIGLSLQRVFTDLKNMDATWLDSLLTPVRLPSIQAIPCAP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

AGTRL1 Peptide
DF4853-BP 1 mg

AGTRL1 Peptide

Sign In for Pricing
View Details
Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1), Recombinant, Rabbit, His-Tag
054699-01 10 µg

Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1), Recombinant, Rabbit, His-Tag

Sign In for Pricing
View Details
Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1), Recombinant, Rabbit, His-Tag
054699-02 50 µg

Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1), Recombinant, Rabbit, His-Tag

Sign In for Pricing
View Details
Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1), Recombinant, Rabbit, His-Tag
054699-03 100 µg

Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1), Recombinant, Rabbit, His-Tag

Sign In for Pricing
View Details
Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1), Recombinant, Rabbit, His-Tag
054699-04 200 µg

Lectin Like Oxidized Low Density Lipoprotein Receptor 1 (LOX1), Recombinant, Rabbit, His-Tag

Sign In for Pricing
View Details
Ang1 Protein Vector (Rat) (pPM-C-His)
PV253525 500 ng

Ang1 Protein Vector (Rat) (pPM-C-His)

Sign In for Pricing
View Details