Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Hnrnpa2b1 protein

This Mouse Hnrnpa2b1 protein spans the amino acid sequence from region 1-353aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

HnRNP A2/B1 (Hnrpa2b1)

UniProt

O88569

Expression Region

1-353aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEKTLETVPLERKKREKEQFRKLFIGGLSFETTEESLRNYYEQWGKLTDCVVMRDPASKRSRGFGFVTFSSMAEVDAAMAARPHSIDGRVVEPKRAVAREESGKPGAHVTVKKLFVGGIKEDTEEHHLRDYFEEYGKIDTIEIITDRQSGKKRGFGFVTFDDHDPVDKIVLQKYHTINGHNAEVRKALSRQEMQEVQSSRSGRGGNFGFGDSRGGGGNFGPGPGSNFRGGSDGYGSGRGFGDGYNGYGGGPGGGNFGGSPGYGGGRGGYGGGGPGYGNQGGGYGGGYDNYGGGNYGSGSYNDFGNYNQQPSNYGPMKSGNFGGSRNMGGPYGGGNYGPGGSGGSGGYGGRSRY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Transfer Factor (TF) ELISA Kit
MBS9366331-01 48 Well

Rat Transfer Factor (TF) ELISA Kit

Sign In for Pricing
View Details
Rat Transfer Factor (TF) ELISA Kit
MBS9366331-02 96 Well

Rat Transfer Factor (TF) ELISA Kit

Sign In for Pricing
View Details
Rat Transfer Factor (TF) ELISA Kit
MBS9366331-03 5x 96 Well

Rat Transfer Factor (TF) ELISA Kit

Sign In for Pricing
View Details
Rat Transfer Factor (TF) ELISA Kit
MBS9366331-04 10x 96 Well

Rat Transfer Factor (TF) ELISA Kit

Sign In for Pricing
View Details
AG-120
MBS130721-01 100 mg

AG-120

Sign In for Pricing
View Details
AG-120
MBS130721-02 500 mg

AG-120

Sign In for Pricing
View Details