Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human GRIN1 protein

This Human GRIN1 protein spans the amino acid sequence from region 834-938aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Glutamate [NMDA] receptor subunit zeta-1 (N-methyl-D-aspartate receptor subunit NR1) (NMD-R1) (GluN1) (NMDAR1)

UniProt

Q05586

Expression Region

834-938aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EIAYKRHKDARRKQMQLAFAAVNVWRKNLQDRKSGRAEPDPKKKATFRAITSTLASSFKRRRSSKDTSTGGGRGALQNQKDTVLPRRAIEREEGQLQLCSRHRES

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cynomolgus / Rhesus Macaque IL-11RA baf3 Cell Line
E24C00458 1 Vial

Cynomolgus / Rhesus Macaque IL-11RA baf3 Cell Line

Sign In for Pricing
View Details
PE anti-human CD163
GT10394 25 Tests

PE anti-human CD163

Sign In for Pricing
View Details
Mouse MYD88 ELISA Kit
orb409379-01 24 Tests

Mouse MYD88 ELISA Kit

Sign In for Pricing
View Details
Mouse MYD88 ELISA Kit
orb409379-02 48 Tests

Mouse MYD88 ELISA Kit

Sign In for Pricing
View Details
Mouse MYD88 ELISA Kit
orb409379-03 96 Tests

Mouse MYD88 ELISA Kit

Sign In for Pricing
View Details
Mouse MYD88 ELISA Kit
orb409379-04 5 x 96 T

Mouse MYD88 ELISA Kit

Sign In for Pricing
View Details