Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Rat Epor protein

This Rat Epor protein spans the amino acid sequence from region 25-249aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPO-R

UniProt

Q07303

Expression Region

25-249aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rattus norvegicus (Rat)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

25.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ASSPSLPDPKFESKAALLASRGSEELLCFTQRLEDLVCFWEEAANSGMGFNYSFSYQLEGESRKSCRLHQAPTVRGSMRFWCSLPTADTSSFVPLELQVTEASGSPRYHRIIHINEVVLLDAPAGLLARRAEEGSHVVLRWLPPPGAPMTTHIRYEVDVSAGNRAGGTQRVEVLEGRTECVLSNLRGGTRYTFAVRARMAEPSFSGFWSAWSEPASLLTASDLDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ZNF398 Rabbit Polyclonal Antibody (HRP)
orb2126459 100 µL

ZNF398 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Recombinant Anti-EMC4 Rabbit mAb
CMA4101-01 30 µL

Recombinant Anti-EMC4 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-EMC4 Rabbit mAb
CMA4101-02 50 μL

Recombinant Anti-EMC4 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-EMC4 Rabbit mAb
CMA4101-03 100 µL

Recombinant Anti-EMC4 Rabbit mAb

Sign In for Pricing
View Details
Recombinant Anti-EMC4 Rabbit mAb
CMA4101-04 200 µL

Recombinant Anti-EMC4 Rabbit mAb

Sign In for Pricing
View Details
Anti-Calcineurin A (Catalytic) Antibody
56336-50 1 Each

Anti-Calcineurin A (Catalytic) Antibody

Sign In for Pricing
View Details