Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD300LB protein

This Human CD300LB protein spans the amino acid sequence from region 18-151aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CLM-7 (CD300 antigen-like family member B) (CMRF35-A2) (Immune receptor expressed on myeloid cells 3) (IREM-3) (Leukocyte mono-Ig-like receptor 5) (Triggering receptor expressed on myeloid cells 5) (TREM-5)

UniProt

A8K4G0

Expression Region

18-151aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Receptor tyrosine-protein kinase erbB-2 ELISA Kit
orb1659356 96 Tests

Rat Receptor tyrosine-protein kinase erbB-2 ELISA Kit

Sign In for Pricing
View Details
Anti-CRMP3 Rabbit pAb
GB112592-100 100 μL

Anti-CRMP3 Rabbit pAb

Sign In for Pricing
View Details
Anti-CD19 (Immunomedics hA19)
C00648-1mg*5 5x 1mg

Anti-CD19 (Immunomedics hA19)

Sign In for Pricing
View Details
Bronopol
orb1310205-01 1 ml x 10 mM (in DMSO)

Bronopol

Sign In for Pricing
View Details
Bronopol
orb1310205-02 50 g

Bronopol

Sign In for Pricing
View Details
Dynein Intermediate Chain 1
MBS8565620-01 0.1 mL

Dynein Intermediate Chain 1

Sign In for Pricing
View Details