Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ASMT protein

This Human ASMT protein spans the amino acid sequence from region 1-345aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hydroxyindole O-methyltransferase (HIOMT)

UniProt

P46597

Expression Region

1-345aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

45.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSSEDQAYRLLNDYANGFMVSQVLFAACELGVFDLLAEAPGPLDVAAVAAGVRASAHGTELLLDICVSLKLLKVETRGGKAFYRNTELSSDYLTTVSPTSQCSMLKYMGRTSYRCWGHLADAVREGRNQYLETFGVPAEELFTAIYRSEGERLQFMQALQEVWSVNGRSVLTAFDLSVFPLMCDLGGGAGALAKECMSLYPGCKITVFDIPEVVWTAKQHFSFQEEEQIDFQEGDFFKDPLPEADLYILARVLHDWADGKCSHLLERIYHTCKPGGGILVIESLLDEDRRGPLLTQLYSLNMLVQTEGQERTPTHYHMLLSSAGFRDFQFKKTGAIYDAILARK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

SUZ12 3'UTR GFP Stable Cell Line
TU074965 1.0 mL

SUZ12 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
NVL Peptide - middle region
MBS3247945-01 0.1 mg

NVL Peptide - middle region

Sign In for Pricing
View Details
NVL Peptide - middle region
MBS3247945-02 5x 0.1 mg

NVL Peptide - middle region

Sign In for Pricing
View Details
1810027O10Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)
K4726305 3x 1.0 µg

1810027O10Rik sgRNA CRISPR/Cas9 All-in-One Lentivector set (Mouse)

Sign In for Pricing
View Details
Rabbit Monoclonal c-Myc Antibody (MYC/7854R) [FITC]
NBP3-20789F 0.1 mL

Rabbit Monoclonal c-Myc Antibody (MYC/7854R) [FITC]

Sign In for Pricing
View Details
Rabbit Polyclonal EMAP-II/AIMP1 Antibody [DyLight 405]
NBP2-99128V 0.1 mL

Rabbit Polyclonal EMAP-II/AIMP1 Antibody [DyLight 405]

Sign In for Pricing
View Details