Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human AADAC protein

This Human AADAC protein spans the amino acid sequence from region 24-399aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DAC

UniProt

P22760

Expression Region

24-399aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PDNVEEPWRMMWINAHLKTIQNLATFVELLGLHHFMDSFKVVGSFDEVPPTSDENVTVTETKFNNILVRVYVPKRKSEALRRGLFYIHGGGWCVGSAALSGYDLLSRWTADRLDAVVVSTNYRLAPKYHFPIQFEDVYNALRWFLRKKVLAKYGVNPERIGISGDSAGGNLAAAVTQQLLDDPDVKIKLKIQSLIYPALQPLDVDLPSYQENSNFLFLSKSLMVRFWSEYFTTDRSLEKAMLSRQHVPVESSHLFKFVNWSSLLPERFIKGHVYNNPNYGSSELAKKYPGFLDVRAAPLLADDNKLRGLPLTYVITCQYDLLRDDGLMYVTRLRNTGVQVTHNHVEDGFHGAFSFLGLKISHRLINQYIEWLKENL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

OR8S21P CRISPR All-in-one AAV vector set (with saCas9)(Human)
35690151 3x 1.0 µg DNA

OR8S21P CRISPR All-in-one AAV vector set (with saCas9)(Human)

Sign In for Pricing
View Details
PRKCSH Antibody, FITC conjugated
A39302-100UG 100 µg

PRKCSH Antibody, FITC conjugated

Sign In for Pricing
View Details
ETS translocation variant 5 (ETV5) Human ELISA Kit
D2680 96 Tests

ETS translocation variant 5 (ETV5) Human ELISA Kit

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Transcriptional regulatory protein prrA (prrA)
MBS1104944-01 0.02 mg (E-Coli)

Recombinant Mycobacterium bovis Transcriptional regulatory protein prrA (prrA)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Transcriptional regulatory protein prrA (prrA)
MBS1104944-02 0.1 mg (E-Coli)

Recombinant Mycobacterium bovis Transcriptional regulatory protein prrA (prrA)

Sign In for Pricing
View Details
Recombinant Mycobacterium bovis Transcriptional regulatory protein prrA (prrA)
MBS1104944-03 0.02 mg (Yeast)

Recombinant Mycobacterium bovis Transcriptional regulatory protein prrA (prrA)

Sign In for Pricing
View Details