Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human OR5V1 protein

This Human OR5V1 protein spans the amino acid sequence from region 1-321aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hs6M1-21 (Olfactory receptor OR6-26)

UniProt

Q9UGF6

Expression Region

1-321aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MERKNQTAITEFIILGFSNLNELQFLLFTIFFLTYFCTLGGNILIILTTVTDPHLHTPMYYFLGNLAFIDICYTTSNVPQMMVHLLSKKKSISYVGCVVQLFAFVFFVGSECLLLAAMAYDRYIAICNPLRYSVILSKVLCNQLAASCWAAGFLNSVVHTVLTFCLPFCGNNQINYFFCDIPPLLILSCGNTSVNELALLSTGVFIGWTPFLCIVLSYICIISTILRIQSSEGRRKAFSTCASHLAIVFLFYGSAIFTYVRPISTYSLKKDRLVSVLYSVVTPMLNPIIYTLRNKDIKEAVKTIGSKWQPPISSLDSKLTY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue, Total Protein, Human Adult Normal, Lymph node HisTekTM
T5595-6549 1 mg

Tissue, Total Protein, Human Adult Normal, Lymph node HisTekTM

Sign In for Pricing
View Details
SP140 Rabbit Polyclonal Antibody (RBITC)
orb1081282 100 µL

SP140 Rabbit Polyclonal Antibody (RBITC)

Sign In for Pricing
View Details
2-Methyl-1H-imidazole-5-carboxylic acid
282519-01 50 mg

2-Methyl-1H-imidazole-5-carboxylic acid

Sign In for Pricing
View Details
2-Methyl-1H-imidazole-5-carboxylic acid
282519-02 100 mg

2-Methyl-1H-imidazole-5-carboxylic acid

Sign In for Pricing
View Details
2-Methyl-1H-imidazole-5-carboxylic acid
282519-03 250 mg

2-Methyl-1H-imidazole-5-carboxylic acid

Sign In for Pricing
View Details
2-Methyl-1H-imidazole-5-carboxylic acid
282519-04 500 mg

2-Methyl-1H-imidazole-5-carboxylic acid

Sign In for Pricing
View Details