Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Neu4 protein

This Mouse Neu4 protein spans the amino acid sequence from region 1-478aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-acetyl-alpha-neuraminidase 4 (Neuraminidase 4)

UniProt

Q8BZL1

Expression Region

1-478aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGPTRVPRRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGTLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVLGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGKICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFLAPPSIEPQDDRWTGSPRNTPHSPCFNLRVQESSGEGARGLLERWMPRLPLCYPQSRSPENHGLEPGSDGDKTSWTPECPMSSDSMLQSPTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWVIYEGPSGYSDLAFLGPMPGASLVFACLFESGTRTSYEDISFCLFSLADVLENVPTGLEMLSLRDKAQGHCWPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

PCMV-EGFP-ACACA-Neo Plasmid
PVT73773 2 µg

PCMV-EGFP-ACACA-Neo Plasmid

Sign In for Pricing
View Details
Anti HBeAg
SA0011 100 µL

Anti HBeAg

Sign In for Pricing
View Details
MARCKSL1 Recombinant Protein (Human)
OPCA04920-20UG 20 µg

MARCKSL1 Recombinant Protein (Human)

Sign In for Pricing
View Details
ERAB Antibody
MBS854010-01 0.1 mg

ERAB Antibody

Sign In for Pricing
View Details
ERAB Antibody
MBS854010-02 0.1 mL (AF635)

ERAB Antibody

Sign In for Pricing
View Details
ERAB Antibody
MBS854010-03 0.1 mL (AF610)

ERAB Antibody

Sign In for Pricing
View Details