Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Neu4 protein

This Mouse Neu4 protein spans the amino acid sequence from region 1-478aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

N-acetyl-alpha-neuraminidase 4 (Neuraminidase 4)

UniProt

Q8BZL1

Expression Region

1-478aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

58.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGPTRVPRRTVLFQRERTGLTYRVPALLCVPPRPTLLAFAEQRLSPDDSHAHRLVLRRGTLTRGSVRWGTLSVLETAVLEEHRSMNPCPVLDEHSGTIFLFFIAVLGHTPEAVQIATGKNAARLCCVTSCDAGLTWGSVRDLTEEAIGAALQDWATFAVGPGHGVQLRSGRLLVPAYTYHVDRRECFGKICWTSPHSLAFYSDDHGISWHCGGLVPNLRSGECQLAAVDGDFLYCNARSPLGNRVQALSADEGTSFLPGELVPTLAETARGCQGSIVGFLAPPSIEPQDDRWTGSPRNTPHSPCFNLRVQESSGEGARGLLERWMPRLPLCYPQSRSPENHGLEPGSDGDKTSWTPECPMSSDSMLQSPTWLLYSHPAGRRARLHMGIYLSRSPLDPHSWTEPWVIYEGPSGYSDLAFLGPMPGASLVFACLFESGTRTSYEDISFCLFSLADVLENVPTGLEMLSLRDKAQGHCWPS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1341 (NM_146853) Mouse Tagged ORF Clone Lentiviral Particle
MR213926L4V 200 µL

Olfr1341 (NM_146853) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Lentiviral human CANT1 shRNA (UAS) - Lentiviral human CANT1 shRNA (UAS, RFP) (100)
GTR15096444 1 Vial

Lentiviral human CANT1 shRNA (UAS) - Lentiviral human CANT1 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
GENLISA™ Human S100 calcium Binding Protein A8 / A9 (S100A8 / A9) ELISA
KBH4465 1x 96 Well

GENLISA™ Human S100 calcium Binding Protein A8 / A9 (S100A8 / A9) ELISA

Sign In for Pricing
View Details
RPS27L Rabbit Polyclonal Antibody
TA315441 100 µL

RPS27L Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human H3C3 Pre-designed siRNA Set A
SI006856A 1 Each

Human H3C3 Pre-designed siRNA Set A

Sign In for Pricing
View Details
RUVBL2 (RuvB-like 2, RVB2, TIH2, ECP51, TIP48, CGI-46, INO80J, Reptin, TIP49B) (MaxLight 750)
MBS6436504-01 0.1 mL

RUVBL2 (RuvB-like 2, RVB2, TIH2, ECP51, TIP48, CGI-46, INO80J, Reptin, TIP49B) (MaxLight 750)

Sign In for Pricing
View Details