Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Virus Pret-110 protein

This Virus Pret-110 protein spans the amino acid sequence from region 1-61aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein p12

UniProt

P0C9Y3

Expression Region

1-61aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) (ASFV)

Field of Research

Infectious Disease & Virology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

12.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALDGSSGGGSNVETLLIVAIIVVIMAIMLYYFWWMPRQQKKCSKAEECTCNNGSCSLKTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Apolipoprotein E,E2,E3,E4 (Apo E,E2,E3,E4) (MaxLight 650)
MBS6220198-01 0.1 mL

Apolipoprotein E,E2,E3,E4 (Apo E,E2,E3,E4) (MaxLight 650)

Sign In for Pricing
View Details
Apolipoprotein E,E2,E3,E4 (Apo E,E2,E3,E4) (MaxLight 650)
MBS6220198-02 5x 0.1 mL

Apolipoprotein E,E2,E3,E4 (Apo E,E2,E3,E4) (MaxLight 650)

Sign In for Pricing
View Details
Human MDK Protein Lysate 20ug
IHUMDKPLLY20UG 20 µg

Human MDK Protein Lysate 20ug

Sign In for Pricing
View Details
Human anti-Trypanosoma cruzi FP6 IgM
A11A82-FP6-M 1 Each

Human anti-Trypanosoma cruzi FP6 IgM

Sign In for Pricing
View Details
Leucasin
orb1696537 25 mg

Leucasin

Sign In for Pricing
View Details
LC3B Rabbit pAb Antibody
orb763705-01 50 μL

LC3B Rabbit pAb Antibody

Sign In for Pricing
View Details