Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human G protein-coupled receptor 20 variant protein

This Human G protein-coupled receptor 20 variant protein spans the amino acid sequence from region 1-273aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q59GP3

Expression Region

1-273aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-Chloro-2-(4-chlorophenyl)imidazo[1,2-a]pyridine
TRC-C365600-50MG 50 mg

6-Chloro-2-(4-chlorophenyl)imidazo[1,2-a]pyridine

Sign In for Pricing
View Details
Fmoc-Ala TentaGel® R TRT Resin
RA1201.5G 5 g

Fmoc-Ala TentaGel® R TRT Resin

Sign In for Pricing
View Details
(S,R,S,S)-Orlistat
TRC-O686485-2MG 2 mg

(S,R,S,S)-Orlistat

Sign In for Pricing
View Details
Ribonuclease A (RNase A), High Purity Grade, 1g
PC0713-1g 1 g

Ribonuclease A (RNase A), High Purity Grade, 1g

Sign In for Pricing
View Details
a-Ethyl 2C-D Hydrochloride
TRC-E594260-5MG 5 mg

a-Ethyl 2C-D Hydrochloride

Sign In for Pricing
View Details
Large Capacity Water Purification System BCPS-418
BCPS-418 1 Unit

Large Capacity Water Purification System BCPS-418

Sign In for Pricing
View Details