Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human G protein-coupled receptor 20 variant protein

This Human G protein-coupled receptor 20 variant protein spans the amino acid sequence from region 1-273aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

Q59GP3

Expression Region

1-273aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

TPSVIYTINLVVTDLLVGLSLPTRFAVYYGARGCLRCAFPHVLGYFLNMHCSILFLTCICVDRYLAIVRPEGSRRCRQPACARAVCAFVWLAAGAVTLSVLGVTGSRPCCRVFALTVLEFLLPLLVISVFTGRIMCALSRPGLLHQGRQRRVRAMQLLLTVLIIFLVCFTPFHARQVAVALWPDMPHHTSLVVYHVAVTLSSLNSCMDPIVYCFVTSGFQATVRGLFGQHGEREPSSGDVVSMHRSSKGSGRHHILSAGPHALTQALANGPEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LRRC26 Rabbit Polyclonal Antibody (Biotin)
orb454842 100 µL

LRRC26 Rabbit Polyclonal Antibody (Biotin)

Sign In for Pricing
View Details
MAD2L1BP Polyclonal Antibody
RD75253A-01 20 µL

MAD2L1BP Polyclonal Antibody

Sign In for Pricing
View Details
MAD2L1BP Polyclonal Antibody
RD75253A-02 60 μL

MAD2L1BP Polyclonal Antibody

Sign In for Pricing
View Details
MAD2L1BP Polyclonal Antibody
RD75253A-03 120 μL

MAD2L1BP Polyclonal Antibody

Sign In for Pricing
View Details
MAD2L1BP Polyclonal Antibody
RD75253A-04 200 µL

MAD2L1BP Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Mycobacterium Marinum murB Protein (aa 1-366)
VAng-Yyj4466-500gEcoli 500 µg (E. coli)

Recombinant Mycobacterium Marinum murB Protein (aa 1-366)

Sign In for Pricing
View Details