Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tmem173 protein

This Mouse Tmem173 protein spans the amino acid sequence from region 1-378aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MSTING (Endoplasmic reticulum interferon stimulator) (ERIS) (Mediator of IRF3 activation) (Transmembrane protein 173) (Eris) (Mita) (Mpys) (Sting)

UniProt

Q3TBT3

Expression Region

1-378aa

Tag

N-terminal 10xHis-tagged

Source

In vitro E.coli expression system

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MPYSNLHPAIPRPRGHRSKYVALIFLVASLMILWVAKDPPNHTLKYLALHLASHELGLLLKNLCCLAEELCHVQSRYQGSYWKAVRACLGCPIHCMAMILLSSYFYFLQNTADIYLSWMFGLLVLYKSLSMLLGLQSLTPAEVSAVCEEKKLNVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPTDGNSFSLSQEVLRHIRQEEKEEVTMNAPMTSVAPPPSVLSQEPRLLISGMDQPLPLRTDLI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 1-pyrimidin-2-ylpiperidine-3-carboxylate
OR111489 1 g

Ethyl 1-pyrimidin-2-ylpiperidine-3-carboxylate

Sign In for Pricing
View Details
SLC45A4 Protein Vector (Mouse) (pPB-C-His)
PV230998 500 ng

SLC45A4 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
ZNF663, CT (ZNF663, Zinc finger protein 663) (FITC)
MBS6367353-01 0.2 mL

ZNF663, CT (ZNF663, Zinc finger protein 663) (FITC)

Sign In for Pricing
View Details
ZNF663, CT (ZNF663, Zinc finger protein 663) (FITC)
MBS6367353-02 5x 0.2 mL

ZNF663, CT (ZNF663, Zinc finger protein 663) (FITC)

Sign In for Pricing
View Details
RERG Human shRNA Plasmid Kit (Locus ID 85004)
TL302035 1 Kit

RERG Human shRNA Plasmid Kit (Locus ID 85004)

Sign In for Pricing
View Details
GJD3 Rabbit Polyclonal Antibody (HRP)
orb3096382 100 µg

GJD3 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details