Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal BjaIT protein

This Animal BjaIT protein spans the amino acid sequence from region 20-83aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Bj-alpha-IT

UniProt

Q56TT9

Expression Region

20-83aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Hottentotta judaicus (Black scorpion) (Buthotus judaicus)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GRDAYIADNLNCAYTCGSNSYCNTECTKNGAVSGYCQWLGKYGNACWCINLPDKVPIRIPGACR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DTNA sgRNA CRISPR Lentivector set (Human)
K0635601 3x 1.0 µg

DTNA sgRNA CRISPR Lentivector set (Human)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD(N501Y)(His Tag)
MBS2567776-01 0.1 mg

Recombinant SARS-CoV-2 Spike RBD(N501Y)(His Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD(N501Y)(His Tag)
MBS2567776-02 1 mg

Recombinant SARS-CoV-2 Spike RBD(N501Y)(His Tag)

Sign In for Pricing
View Details
Recombinant SARS-CoV-2 Spike RBD(N501Y)(His Tag)
MBS2567776-03 5x 1 mg

Recombinant SARS-CoV-2 Spike RBD(N501Y)(His Tag)

Sign In for Pricing
View Details
Cytochrome P450 2A6 Blocking Peptide
CBP3197-01 1 mg

Cytochrome P450 2A6 Blocking Peptide

Sign In for Pricing
View Details
Cytochrome P450 2A6 Blocking Peptide
CBP3197-02 5 mg

Cytochrome P450 2A6 Blocking Peptide

Sign In for Pricing
View Details