Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Tb2-II protein

This Animal Tb2-II protein spans the amino acid sequence from region 1-62aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P-Mice-Ins-beta* NaTx5.4

UniProt

P60276

Expression Region

1-62aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Tityus bahiensis (Brazilian scorpion)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ANKRD54 Polyclonal Antibody, APC-Cy5.5 Conjugated
bs-8309R-APC-Cy5.5 100 µL

ANKRD54 Polyclonal Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Anti-Phospholipase A2, Group Iid (PLA2G2D) Polyclonal antibody
FY-AB36390-01 1 mL

Anti-Phospholipase A2, Group Iid (PLA2G2D) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Phospholipase A2, Group Iid (PLA2G2D) Polyclonal antibody
FY-AB36390-02 100 µL

Anti-Phospholipase A2, Group Iid (PLA2G2D) Polyclonal antibody

Sign In for Pricing
View Details
Anti-Phospholipase A2, Group Iid (PLA2G2D) Polyclonal antibody
FY-AB36390-03 200 µL

Anti-Phospholipase A2, Group Iid (PLA2G2D) Polyclonal antibody

Sign In for Pricing
View Details
Phospho-AMPK beta 1 + AMPK beta 2 (Ser182/Ser184) Polyclonal Antibody, Cy5 Conjugated
bs-3027R-Cy5 100 µL

Phospho-AMPK beta 1 + AMPK beta 2 (Ser182/Ser184) Polyclonal Antibody, Cy5 Conjugated

Sign In for Pricing
View Details
STFR P021-148x210-AL-CRD/1 AC Signs
824556 Card of 1 Pictogram(s)

STFR P021-148x210-AL-CRD/1 AC Signs

Sign In for Pricing
View Details