Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Tb2-II protein

This Animal Tb2-II protein spans the amino acid sequence from region 1-62aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P-Mice-Ins-beta* NaTx5.4

UniProt

P60276

Expression Region

1-62aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Tityus bahiensis (Brazilian scorpion)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KEGYAMDHEGCKFSCFIRPSGFCDGYCKTHLKASSGYCAWPACYCYGVPSNIKVWDYATNKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CES1 Protein Lysate
OCOA00452-20UG 20 µg

CES1 Protein Lysate

Sign In for Pricing
View Details
Fmoc-L-alanine Rink amide AM resin
sc-470156 1 g

Fmoc-L-alanine Rink amide AM resin

Sign In for Pricing
View Details
MELK Recombinant Antibody, HRP Conjugated
bsm-61708R-HRP-TR 20 µL

MELK Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
RGS5, NT (RGS5, Regulator of G-protein signaling 5) (AP) discontinued
041015-AP 200 µL

RGS5, NT (RGS5, Regulator of G-protein signaling 5) (AP) discontinued

Sign In for Pricing
View Details
EZ Cap™ Mouse P16 mRNA
R1041-1 1 mg (1 mg/mL)

EZ Cap™ Mouse P16 mRNA

Sign In for Pricing
View Details
pCMV-HA-FLAG-Htr2a-Neo Plasmid
PVT47189 2 µg

pCMV-HA-FLAG-Htr2a-Neo Plasmid

Sign In for Pricing
View Details