Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Lqh7 protein

This Animal Lqh7 protein spans the amino acid sequence from region 1-66aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lqh VII (LqhVII)

UniProt

P59357

Expression Region

1-66aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRDGYIAKPENCAHHCFPGSSGCDTLCKENGGTGGHCGFKVGHGTACWCNALPDKVGIIVDGVKCH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue FFPE Sections, Skin
CS713605 5x 5 µm

Tissue FFPE Sections, Skin

Sign In for Pricing
View Details
Human Prokineticin 1 (PROK1) activation kit by CRISPRa
GA113540 1 Kit

Human Prokineticin 1 (PROK1) activation kit by CRISPRa

Sign In for Pricing
View Details
Progesterone Receptor (PR500), CF405S conjugate, 0.1mg/mL
BNC040500-500 1x 500 µL

Progesterone Receptor (PR500), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ciglitazone
TRC-C441000-1MG 1 mg

Ciglitazone

Sign In for Pricing
View Details
Cetn3 Mouse Gene Knockout Kit (CRISPR)
KN503206 1 Kit

Cetn3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Recombinant Human CD16a/FCGR3A Protein (176 Val, His&AVI Tag), Biotinylated
PKSH030282-01 20 µg

Recombinant Human CD16a/FCGR3A Protein (176 Val, His&AVI Tag), Biotinylated

Sign In for Pricing
View Details