Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Lqh6 protein

This Animal Lqh6 protein spans the amino acid sequence from region 1-64aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lqh VI (LqhVI)

UniProt

P59356

Expression Region

1-64aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRDGYIAQPENCVYHCIPDCDTLCKDNGGTGGHCGFKLGHGIACWCNALPDNVGIIVDGVKCHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Motilin receptor (MLNR) (C-term) Rabbit Polyclonal Antibody
AP52705PU-N 400 µL

Motilin receptor (MLNR) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human QRFP activation kit by CRISPRa
GA117637 1 Kit

Human QRFP activation kit by CRISPRa

Sign In for Pricing
View Details
N-[2-(p-Bromocinnamylamino)ethyl]-5-Isoquinoline Sulfonamide
TRC-B682440-5MG 5 mg

N-[2-(p-Bromocinnamylamino)ethyl]-5-Isoquinoline Sulfonamide

Sign In for Pricing
View Details
CGS 21680A
TRC-C291790-5MG 5 mg

CGS 21680A

Sign In for Pricing
View Details
p16INK4A (CDKN2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H5]
TA805237AM 100 µL

p16INK4A (CDKN2A) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI5H5]

Sign In for Pricing
View Details
NRF1 (NRF1/2609), Biotin conjugate, 0.1mg/mL
BNCB2609-500 1x 500 µL

NRF1 (NRF1/2609), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details