Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal Lqh6 protein

This Animal Lqh6 protein spans the amino acid sequence from region 1-64aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lqh VI (LqhVI)

UniProt

P59356

Expression Region

1-64aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Leiurus hebraeus (Deathstalker scorpion) (Leiurus quinquestriatus hebraeus)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

10.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VRDGYIAQPENCVYHCIPDCDTLCKDNGGTGGHCGFKLGHGIACWCNALPDNVGIIVDGVKCHK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multi-Well Plates
DP10UR-9-NS 50 Pack/Case

Multi-Well Plates

Sign In for Pricing
View Details
Phenylmercuric Chloride
TRC-P335658-1G 1 g

Phenylmercuric Chloride

Sign In for Pricing
View Details
rac Cetirizine N-Oxide > 90% by HPLC(Mixture of Diastereomers)
TRC-C281110-10MG 10 mg

rac Cetirizine N-Oxide > 90% by HPLC(Mixture of Diastereomers)

Sign In for Pricing
View Details
3-Amino-1-propanol
TRC-A628130-1G 1 g

3-Amino-1-propanol

Sign In for Pricing
View Details
UCHL3 (NM_006002) Human Over-expression Lysate
LY401817 100 µg

UCHL3 (NM_006002) Human Over-expression Lysate

Sign In for Pricing
View Details
SARS2 (N-term) Rabbit Polyclonal Antibody
AP14668PU-N 400 µL

SARS2 (N-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details