Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Animal LqqIT1 protein

This Animal LqqIT1 protein spans the amino acid sequence from region 1-70aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Insect toxin 1 (LqqIT1')

UniProt

P19856

Expression Region

1-70aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Leiurus quinquestriatus quinquestriatus (Egyptian scorpion) (Deathstalker scorpion)

Field of Research

Epigenetics, Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

11.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KKNGYAVDSSGKAPECLLSNYCYNECTKVHYADKGYCCLLSCYCVGLSDDKKVLEISDARKKYCDFVTIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Tbck Pre-designed siRNA Set A
SI214253A 1 Each

Rat Tbck Pre-designed siRNA Set A

Sign In for Pricing
View Details
Anti-Spindly/SPDL1 Antibody Picoband®, Dylight550 Conjugate
A12722-2-Dylight550 100 µg

Anti-Spindly/SPDL1 Antibody Picoband®, Dylight550 Conjugate

Sign In for Pricing
View Details
Human GKN1 knockout cell line
ABC-KH6091 1 Vial

Human GKN1 knockout cell line

Sign In for Pricing
View Details
Tyrosol
BUP18115 1 Each

Tyrosol

Sign In for Pricing
View Details
AMAC1L2 (SLC35G5) (NM_054028) Human Over-expression Lysate
LS083650-100ug 100 µg

AMAC1L2 (SLC35G5) (NM_054028) Human Over-expression Lysate

Sign In for Pricing
View Details
CD38 Recombinant Protein
OPCD01825-50UG 50 µg

CD38 Recombinant Protein

Sign In for Pricing
View Details