Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse Tectb protein

This Mouse Tectb protein spans the amino acid sequence from region 18-305aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Tectb, Beta-tectorin

UniProt

O08524

Expression Region

18-305aa

Tag

N-terminal 10xHis-tagged and C-terminal Myc-tagged

Source

Baculovirus

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

36.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

KSCTPNKADVILVFCYPKTIITKIPECPYGWEVHQLALGGLCYNGVHEGGYYQFVIPDLSPKNKSYCGTQSEYKPPIYHFYSHIVSNDSTVIVKNQPVNYSFSCTYHSTYLVNQAAFDQRVATVHVKNGSMGTFESQLSLNFYTNAKFSTKKEAPFVLETSEIGSDLFAGVEAKGLSVRFKVVLNSCWATPSADFMYPLQWQLINKGCPTDETVLVHENGKDHRATFQFNAFRFQNIPKLSKVWLHCETFICDSEKLSCPVNCDKRKRMLRDQTGGVLVVELSLRSRA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cdc20 Lentiviral Activation Particles (h)
sc-400583-LAC 200 µL

Cdc20 Lentiviral Activation Particles (h)

Sign In for Pricing
View Details
Recombinant Human MYRIP Protein
E30P64937B 50 µg

Recombinant Human MYRIP Protein

Sign In for Pricing
View Details
1-Ethyl-3-propylimidazolium tetrafluoroborate
IL-0283-HP-0025 25 g

1-Ethyl-3-propylimidazolium tetrafluoroborate

Sign In for Pricing
View Details
Mouse Slc35f4 qPCR Primer Pair
QM43754S 200 Tests

Mouse Slc35f4 qPCR Primer Pair

Sign In for Pricing
View Details
Fibronectin Antibody
OAMA01306-1MG 1 mg

Fibronectin Antibody

Sign In for Pricing
View Details
Rat Nucleoside Diphosphate-Linked Moiety X Motif 22 (NUDT22) ELISA Kit
abx536226 96 Tests

Rat Nucleoside Diphosphate-Linked Moiety X Motif 22 (NUDT22) ELISA Kit

Sign In for Pricing
View Details