Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY96 protein

This Human LY96 protein spans the amino acid sequence from region 19-160aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ESOP-1 (Protein MD-2) (ESOP1) (MD2)

UniProt

Q9Y6Y9

Expression Region

19-160aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

HER2/neu Fragment (869-877)
orb321590-01 1 mg

HER2/neu Fragment (869-877)

Sign In for Pricing
View Details
HER2/neu Fragment (869-877)
orb321590-02 2 mg

HER2/neu Fragment (869-877)

Sign In for Pricing
View Details
HER2/neu Fragment (869-877)
orb321590-03 5 mg

HER2/neu Fragment (869-877)

Sign In for Pricing
View Details
Bovine Lysophosphatidylcholine Acyltransferase 1 ELISA kit
GTR10400682 96 Well

Bovine Lysophosphatidylcholine Acyltransferase 1 ELISA kit

Sign In for Pricing
View Details
Tropomodulin 2 Recombinant Rabbit Monoclonal Antibody [JE53-06]
ET7110-27 100 µL

Tropomodulin 2 Recombinant Rabbit Monoclonal Antibody [JE53-06]

Sign In for Pricing
View Details
Lentiviral mouse Zfp934 shRNA (UAS) - Lentiviral mouse Zfp934 shRNA (UAS) (100)
GTR15196266 1 Vial

Lentiviral mouse Zfp934 shRNA (UAS) - Lentiviral mouse Zfp934 shRNA (UAS) (100)

Sign In for Pricing
View Details