Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human LY96 protein

This Human LY96 protein spans the amino acid sequence from region 19-160aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

ESOP-1 (Protein MD-2) (ESOP1) (MD2)

UniProt

Q9Y6Y9

Expression Region

19-160aa

Tag

N-terminal 10xHis-tagged

Source

Baculovirus

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QKQYWVCNSSDASISYTYCDKMQYPISINVNPCIELKGSKGLLHIFYIPRRDLKQLYFNLYITVNTMNLPKRKEVICRGSDDDYSFCRALKGETVNTTISFSFKGIKFSKGKYKCVVEAISGSPEEMLFCLEFVILHQPNSN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal human p70 S6 Kinas Antibody
orb1409404-01 100 µg

Mouse Monoclonal human p70 S6 Kinas Antibody

Sign In for Pricing
View Details
Mouse Monoclonal human p70 S6 Kinas Antibody
orb1409404-02 50 µg

Mouse Monoclonal human p70 S6 Kinas Antibody

Sign In for Pricing
View Details
Cys1 (NM_001161807) Mouse Untagged Clone
MC208314 10 µg

Cys1 (NM_001161807) Mouse Untagged Clone

Sign In for Pricing
View Details
Human NMI knockdown cell line
ABC-KD10183 1 Vial

Human NMI knockdown cell line

Sign In for Pricing
View Details
PE anti-mouse CD94
GT01323 200 µg

PE anti-mouse CD94

Sign In for Pricing
View Details
Signaling Lymphocytic Activation Molecule Family, Member 7 (SLAMF7) Antibody
abx237903 100 µg

Signaling Lymphocytic Activation Molecule Family, Member 7 (SLAMF7) Antibody

Sign In for Pricing
View Details