Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CD276 protein

This Human CD276 protein spans the amino acid sequence from region 29-245aa. Purity: Greater than 93% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

4Ig-B7-H3 (B7 homolog 3) (B7-H3) (Costimulatory molecule) (CD276)

UniProt

Q5ZPR3

Expression Region

29-245aa

Tag

C-terminal hFc1-Myc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 93% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 μg/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml.

Form

Lyophilized powder

Molecular Weight

53.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Histone Deacetylase 2 ELISA Kit
MBS755155-01 48 Well

Sheep Histone Deacetylase 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Histone Deacetylase 2 ELISA Kit
MBS755155-02 96 Well

Sheep Histone Deacetylase 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Histone Deacetylase 2 ELISA Kit
MBS755155-03 5x 96 Well

Sheep Histone Deacetylase 2 ELISA Kit

Sign In for Pricing
View Details
Sheep Histone Deacetylase 2 ELISA Kit
MBS755155-04 10x 96 Well

Sheep Histone Deacetylase 2 ELISA Kit

Sign In for Pricing
View Details
GOLGB1 (Golgin Subfamily B Member 1, 372kD Golgi Complex-associated Protein, GCP372, Giantin, Macrogolgin) (APC)
127462-APC 100 µL

GOLGB1 (Golgin Subfamily B Member 1, 372kD Golgi Complex-associated Protein, GCP372, Giantin, Macrogolgin) (APC)

Sign In for Pricing
View Details
AdmiRa-mmu-miR-743a-5p Virus
mm2006 250 µL

AdmiRa-mmu-miR-743a-5p Virus

Sign In for Pricing
View Details