Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human EFNA5 protein

This Human EFNA5 protein spans the amino acid sequence from region 21-203aa. Purity: Greater than 93% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

AL-1 (EPH-related receptor tyrosine kinase ligand 7) (LERK-7)

UniProt

P52803

Expression Region

21-203aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 93% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized EPHA3 at 2 μg/ml can bind human EFNA5, the EC50 of human EFNA5 protein is 0.8674-1.119 ng/ml.

Form

Lyophilized powder

Molecular Weight

50.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

QDPGSKAVADRYAVYWNSSNPRFQRGDYHIDVCINDYLDVFCPHYEDSVPEDKTERYVLYMVNFDGYSACDHTSKGFKRWECNRPHSPNGPLKFSEKFQLFTPFSLGFEFRPGREYFYISSAIPDNGRRSCLKLKVFVRPTNSCMKTIGVHDRVFDVNDKVENSLEPADDTVHESAEPSRGEN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

pOTB7-RAB25 Plasmid
PVT20106 2 µg

pOTB7-RAB25 Plasmid

Sign In for Pricing
View Details
Keratin 20 (phospho-Ser13) rabbit pAb
RA26635-01 50 µL

Keratin 20 (phospho-Ser13) rabbit pAb

Sign In for Pricing
View Details
Keratin 20 (phospho-Ser13) rabbit pAb
RA26635-02 100 µL

Keratin 20 (phospho-Ser13) rabbit pAb

Sign In for Pricing
View Details
FoxO1 (phospho Ser319) Rabbit Polyclonal Antibody
E28PP0114 100 µL

FoxO1 (phospho Ser319) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XRCC4, ID (XRCC4, DNA repair protein XRCC4, X-ray repair cross-complementing protein 4) (APC) discontinued
043933-APC 200 µL

XRCC4, ID (XRCC4, DNA repair protein XRCC4, X-ray repair cross-complementing protein 4) (APC) discontinued

Sign In for Pricing
View Details
Sannamycin B
HY-133060 1 Each

Sannamycin B

Sign In for Pricing
View Details