Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TACSTD2 protein

This Human TACSTD2 protein spans the amino acid sequence from region 27-274aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cell surface glycoprotein Trop-2 (Membrane component chromosome 1 surface marker 1) (Pancreatic carcinoma marker protein GA733-1) (GA733-1) (M1S1) (TROP2)

UniProt

P09758

Expression Region

27-274aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured in cell activity assay using U937 cells. The EC50 for this effect is 190.2-298.6 ng/ml.

Form

Lyophilized powder

Molecular Weight

56.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

HTAAQDNCTCPTNKMTVCSPDGPGGRCQCRALGSGMAVDCSTLTSKCLLLKARMSAPKNARTLVRPSEHALVDNDGLYDPDCDPEGRFKARQCNQTSVCWCVNSVGVRRTDKGDLSLRCDELVRTHHILIDLRHRPTAGAFNHSDLDAELRRLFRERYRLHPKFVAAVHYEQPTIQIELRQNTSQKAAGDVDIGDAAYYFERDIKGESLFQGRGGLDLRVRGEPLQVERTLIYYLDEIPPKFSMKRLT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Medetomidine-d3 Hydrochloride
TRC-M203253-1MG 1 mg

Medetomidine-d3 Hydrochloride

Sign In for Pricing
View Details
Acss2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)
K6741506 1.0 µg DNA

Acss2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 1)

Sign In for Pricing
View Details
Oxyberberin 5mg
A22175-5 5 mg

Oxyberberin 5mg

Sign In for Pricing
View Details
Mouse SFRP4 HEK293 Overexpression Lysate
MBS8116332-01 0.3 mg

Mouse SFRP4 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Mouse SFRP4 HEK293 Overexpression Lysate
MBS8116332-02 5x 0.3 mg

Mouse SFRP4 HEK293 Overexpression Lysate

Sign In for Pricing
View Details
Sf1 Rat Pre-designed siRNA Set A
HY-RS23319 1 Set

Sf1 Rat Pre-designed siRNA Set A

Sign In for Pricing
View Details