Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Tnfrsf17 protein

This Human Tnfrsf17 protein spans the amino acid sequence from region 1-54aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell maturation protein (CD_antigen: CD269)

UniProt

Q02223

Expression Region

1-54aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.

Form

Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Kcne3 shRNA (UAS) - Lentiviral mouseKcne3 shRNA (UAS, GFP) (25)
GTR15246824 1 Vial

Lentiviral mouse Kcne3 shRNA (UAS) - Lentiviral mouseKcne3 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
MGST1 Recombinant Antibody, APC-Cy7 Conjugated
bsm-62485R-APC-Cy7 100 µL

MGST1 Recombinant Antibody, APC-Cy7 Conjugated

Sign In for Pricing
View Details
ADORA2A Antibody : Biotin (OAAF04765-Biotin)
OAAF04765-100UG-Biotin 100 µg

ADORA2A Antibody : Biotin (OAAF04765-Biotin)

Sign In for Pricing
View Details
PLV3-CMV-Rragc-3xFLAG-CopGFP-Puro Plasmid
PVT70408 2 µg

PLV3-CMV-Rragc-3xFLAG-CopGFP-Puro Plasmid

Sign In for Pricing
View Details
Human CRY1 ELISA Kit
MBS8427109 Inquire

Human CRY1 ELISA Kit

Sign In for Pricing
View Details
CDX1 Recombinant Antibody, Cy7 Conjugated
bsm-61940R-Cy7-TR 20 µL

CDX1 Recombinant Antibody, Cy7 Conjugated

Sign In for Pricing
View Details