Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human Tnfrsf17 protein

This Human Tnfrsf17 protein spans the amino acid sequence from region 1-54aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

B-cell maturation protein (CD_antigen: CD269)

UniProt

Q02223

Expression Region

1-54aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 μg/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.

Form

Lyophilized powder

Molecular Weight

34.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal Tryptophan Hydroxylase 1/TPH-1 Antibody (TPH1/7661)
NBP3-27018 100 µg

Mouse Monoclonal Tryptophan Hydroxylase 1/TPH-1 Antibody (TPH1/7661)

Sign In for Pricing
View Details
Rabbit Anti FGFBP1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)
IRBAMLFGFBP1AP719120UL 1 Each

Rabbit Anti FGFBP1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Western Blot)

Sign In for Pricing
View Details
BTBD9 Protein Vector (Human) (pPB-His-GST)
PV327739 500 ng

BTBD9 Protein Vector (Human) (pPB-His-GST)

Sign In for Pricing
View Details
Rabbit anti-PKC delta (pY52) Antibody
YLD6207-01 50 µL

Rabbit anti-PKC delta (pY52) Antibody

Sign In for Pricing
View Details
Rabbit anti-PKC delta (pY52) Antibody
YLD6207-02 100 µL

Rabbit anti-PKC delta (pY52) Antibody

Sign In for Pricing
View Details
Piga Mouse Gene Knockout Kit (CRISPR)
KN513264 1 Kit

Piga Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details