Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RSPO1 protein

This Human RSPO1 protein spans the amino acid sequence from region 31-263aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ40906; RSPO Rspo1; R-spondin; Rspondin; RP23-325M14.2; Roof plate-specific spondin-1

UniProt

Q2MKA7

Expression Region

31-263aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells is 1-10ng/ml.

Form

Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal HNF-3 alpha/FoxA1 Antibody (FOXA1/1514) [mFluor Violet 500 SE]
NBP2-54575MFV500 0.1 mL

Mouse Monoclonal HNF-3 alpha/FoxA1 Antibody (FOXA1/1514) [mFluor Violet 500 SE]

Sign In for Pricing
View Details
Polyclonal Bcl2l2 Antibody - C-terminal region
APR00580G 0.05mg

Polyclonal Bcl2l2 Antibody - C-terminal region

Sign In for Pricing
View Details
Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) creb3l3b Polyclonal Antibody
MBS7190826 Inquire

Rabbit anti-Danio rerio (Zebrafish)(Brachydanio rerio) creb3l3b Polyclonal Antibody

Sign In for Pricing
View Details
Anti-SULT2A1 Antibody (6F592)
TMAY-01858 100 µL

Anti-SULT2A1 Antibody (6F592)

Sign In for Pricing
View Details
ADAT1 rabbit pAb
E44H15326 100 µL

ADAT1 rabbit pAb

Sign In for Pricing
View Details
NMDAR1 (Ab 896) Antibody
79-553 0.1 mg

NMDAR1 (Ab 896) Antibody

Sign In for Pricing
View Details