Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RSPO1 protein

This Human RSPO1 protein spans the amino acid sequence from region 31-263aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RSPO1; R-spondin1; RP11-566C13.1; CRISTIN3; FLJ40906; RSPO Rspo1; R-spondin; Rspondin; RP23-325M14.2; Roof plate-specific spondin-1

UniProt

Q2MKA7

Expression Region

31-263aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to induce Topflash reporter activity in HEK293T human embryonic kidney cells is 1-10ng/ml.

Form

Lyophilized powder

Molecular Weight

27.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

SRGIKGKRQRRISAEGSQACAKGCELCSEVNGCLKCSPKLFILLERNDIRQVGVCLPSCPPGYFDARNPDMNKCIKCKIEHCEACFSHNFCTKCKEGLYLHKGRCYPACPEGSSAANGTMECSSPAQCEMSEWSPWGPCSKKQQLCGFRRGSEERTRRVLHAPVGDHAACSDTKETRRCTVRRVPCPEGQKRRKGGQGRRENANRNLARKESKEAGAGSRRRKGQQQQQQQGTVGPLTSAGPA

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Gm6460 (NM_001037919) Mouse Tagged ORF Clone
MR212294 10 µg

Gm6460 (NM_001037919) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
C11orf17 3'UTR Luciferase Stable Cell Line
TU002729 1.0 mL

C11orf17 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PLEKHM3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
37003111 3x 1.0 µg

PLEKHM3 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
ATRIP (Phospho-Ser224) Antibody
MBS9503346-01 0.05 mL

ATRIP (Phospho-Ser224) Antibody

Sign In for Pricing
View Details
ATRIP (Phospho-Ser224) Antibody
MBS9503346-02 0.1 mL

ATRIP (Phospho-Ser224) Antibody

Sign In for Pricing
View Details
ATRIP (Phospho-Ser224) Antibody
MBS9503346-03 5x 0.1 mL

ATRIP (Phospho-Ser224) Antibody

Sign In for Pricing
View Details