Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CA5B protein

This Human CA5B protein spans the amino acid sequence from region 34-317aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Carbonic Anhydrase 5B Mitochondrial; Carbonate Dehydratase VB; Carbonic Anhydrase VB; CA-VB; CA5B

UniProt

Q9Y2D0

Expression Region

34-317aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The esterase activity is determined to be 233 pmol/min/μg as measured under the described conditions.

Form

Liquid

Molecular Weight

33.77 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length of Mature Protein

Preservative

0.2 μm filtered 20 mM Tris-HCl, 100 mM NaCl, pH 8.0

AA Sequence

CSLYTCTYKTRNRALHPLWESVDLVPGGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHVWNNGYSFLVEFEDSTDKSVIKGGPLEHNYRLKQFHFHWGAIDAWGSEHTVDSKCFPAELHLVHWNAVRFENFEDAALEENGLAVIGVFLKLGKHHKELQKLVDTLPSIKHKDALVEFGSFDPSCLMPTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNFRPLQPLMNRTVRSSFRHDYVLNVQAKPKPATSQATP

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA Kit For Basic leucine zipper and W2 domain-containing protein 2
E15537c 96 Tests

ELISA Kit For Basic leucine zipper and W2 domain-containing protein 2

Sign In for Pricing
View Details
Rabbit Monoclonal Pappalysin-1/PAPP-A Antibody (PAPPA/8804R) [Alexa Fluor 350]
NBP3-20750AF350 0.1 mL

Rabbit Monoclonal Pappalysin-1/PAPP-A Antibody (PAPPA/8804R) [Alexa Fluor 350]

Sign In for Pricing
View Details
Human High mobility group protein B4, HMGB-4 ELISA Kit
CK-bio-11871-01 48 Tests

Human High mobility group protein B4, HMGB-4 ELISA Kit

Sign In for Pricing
View Details
Human High mobility group protein B4, HMGB-4 ELISA Kit
CK-bio-11871-02 96 Tests

Human High mobility group protein B4, HMGB-4 ELISA Kit

Sign In for Pricing
View Details
Human High mobility group protein B4, HMGB-4 ELISA Kit
CK-bio-11871-03 5x 96 Tests

Human High mobility group protein B4, HMGB-4 ELISA Kit

Sign In for Pricing
View Details
Human High mobility group protein B4, HMGB-4 ELISA Kit
CK-bio-11871-04 10x 96 Tests

Human High mobility group protein B4, HMGB-4 ELISA Kit

Sign In for Pricing
View Details