Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MICA protein

This Human MICA protein spans the amino acid sequence from region 24-308aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MHC Class I Polypeptide-Related Sequence A; MIC-A; MICA; PERB11.1

Expression Region

24-308aa

Tag

C-terminal Fc-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse NKG2D (N-6His) at 2 μg/ml can bind Human MICA (C-Fc), the EC50 of Human MICA (C-Fc) is not higher than 10 ng/ml.

Form

Lyophilized powder

Molecular Weight

59.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

EPHSLRYNLTVLSWDGSVQSGFLTEVHLDGQPFLRCDRQKCRAKPQGQWAEDVLGNKTWDRETRDLTGNGKDLRMTLAHIKDQKEGLHSLQEIRVCEIHEDNSTRSSQHFYYDGELFLSQNLETEEWTMPQSSRAQTLAMNVRNFLKEDAMKTKTHYHAMHADCLQELRRYLKSGVVLRRTVPPMVNVTRSEASEGNITVTCRASGFYPWNITLSWRQDGVSLSHDTQQWGDVLPDGNGTYQTWVATRICQGEEQRFTCYMEHSGNHSTHPVPSGKVLVLQSHWQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPR161 Antibody (HRP)
orb241646-01 50 µg

GPR161 Antibody (HRP)

Sign In for Pricing
View Details
GPR161 Antibody (HRP)
orb241646-02 100 µg

GPR161 Antibody (HRP)

Sign In for Pricing
View Details
LY 320135
BL159423-01 10 mg

LY 320135

Sign In for Pricing
View Details
LY 320135
BL159423-02 50 mg

LY 320135

Sign In for Pricing
View Details
LY 320135
BL159423-03 2000 mg

LY 320135

Sign In for Pricing
View Details
LY 320135
BL159423-04 5000 mg

LY 320135

Sign In for Pricing
View Details