Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TRX protein

This Human TRX protein spans the amino acid sequence from region 1-105aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Thioredoxin; Trx; ATL-Derived Factor; ADF; Surface-Associated Sulphydryl Protein; SASP; TXN; TRDX; TRX; TRX1

UniProt

P10599

Expression Region

1-105aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its ability to catalyze the reduction of insulin. The reaction leads to precipitation, which can be measured by absorbance at 650 nm. The specific activity is 0.2-1 Abs/min/mg as measured under the described conditions.

Form

Lyophilized powder

Molecular Weight

13.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Full Length

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.2

AA Sequence

MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIFLEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKLEATINELV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ELISA kit for Human COLEC11 (Collectin Sub-Family Member 11)
E-EL-H0791 96 Tests

ELISA kit for Human COLEC11 (Collectin Sub-Family Member 11)

Sign In for Pricing
View Details
3,3'-Bitolylene-4,4''-diisocyanate 98%
B16970-01 25 g

3,3'-Bitolylene-4,4''-diisocyanate 98%

Sign In for Pricing
View Details
3,3'-Bitolylene-4,4''-diisocyanate 98%
B16970-02 100 g

3,3'-Bitolylene-4,4''-diisocyanate 98%

Sign In for Pricing
View Details
3,3'-Bitolylene-4,4''-diisocyanate 98%
B16970-03 500 g

3,3'-Bitolylene-4,4''-diisocyanate 98%

Sign In for Pricing
View Details
14-3-3z, phosphorylated (Ser58)
303756 100 µL

14-3-3z, phosphorylated (Ser58)

Sign In for Pricing
View Details
Rat C-terminal peptide of bone-specific alkaline phosphatase ELISA Kit
MBS1604762-01 48 Well

Rat C-terminal peptide of bone-specific alkaline phosphatase ELISA Kit

Sign In for Pricing
View Details