Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGHG1 protein

This Human IGHG1 protein spans the amino acid sequence from region 104-330aa (D239E, L241M) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G gamma-1 chain C region; IGHG1

UniProt

P01857

Expression Region

104-330aa (D239E, L241M)

Tag

Tag-Free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to bind Human FCGR3A in functional ELISA is less than 10 ug/ml.

Form

Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Eriocheir sinensis (Chinese mitten crab) allergen
A10Q71 1 Each

Eriocheir sinensis (Chinese mitten crab) allergen

Sign In for Pricing
View Details
NBN Rabbit Polyclonal Antibody (BF350)
orb2463922 100 µL

NBN Rabbit Polyclonal Antibody (BF350)

Sign In for Pricing
View Details
MHC Class II (I-A/I-E) (M5/114.15.2) Rat Monoclonal Antibody
CST 86285S 100 µL

MHC Class II (I-A/I-E) (M5/114.15.2) Rat Monoclonal Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal Cathepsin E Antibody [Biotin]
NBP2-98303B 0.1 mL

Rabbit Polyclonal Cathepsin E Antibody [Biotin]

Sign In for Pricing
View Details
TUBGCP4 (Gamma-tubulin Complex Component 4, 76P, GCP4, GCP-4, Grip76) (MaxLight 650)
MBS6442003-01 0.1 mL

TUBGCP4 (Gamma-tubulin Complex Component 4, 76P, GCP4, GCP-4, Grip76) (MaxLight 650)

Sign In for Pricing
View Details
TUBGCP4 (Gamma-tubulin Complex Component 4, 76P, GCP4, GCP-4, Grip76) (MaxLight 650)
MBS6442003-02 5x 0.1 mL

TUBGCP4 (Gamma-tubulin Complex Component 4, 76P, GCP4, GCP-4, Grip76) (MaxLight 650)

Sign In for Pricing
View Details