Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGHG1 protein

This Human IGHG1 protein spans the amino acid sequence from region 104-330aa (D239E, L241M) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G gamma-1 chain C region; IGHG1

UniProt

P01857

Expression Region

104-330aa (D239E, L241M)

Tag

Tag-Free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to bind Human FCGR3A in functional ELISA is less than 10 ug/ml.

Form

Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C4BPA Antibody (C-term)
E45R05692G-4 50 µL

C4BPA Antibody (C-term)

Sign In for Pricing
View Details
AIMP1 Blocking Peptide
B2023962 0.05 mg

AIMP1 Blocking Peptide

Sign In for Pricing
View Details
SRD5A1 Rabbit Polyclonal Antibody (FITC)
orb2451996 100 µL

SRD5A1 Rabbit Polyclonal Antibody (FITC)

Sign In for Pricing
View Details
MTF-1 (H-6) Alexa Fluor® 546
sc-365090 AF546 200 µg/mL

MTF-1 (H-6) Alexa Fluor® 546

Sign In for Pricing
View Details
Chicken Tyrosinase (TyR) ELISA Kit
YP-W60412-01 48 Tests

Chicken Tyrosinase (TyR) ELISA Kit

Sign In for Pricing
View Details
Chicken Tyrosinase (TyR) ELISA Kit
YP-W60412-02 96 Tests

Chicken Tyrosinase (TyR) ELISA Kit

Sign In for Pricing
View Details