Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGHG1 protein

This Human IGHG1 protein spans the amino acid sequence from region 104-330aa (D239E, L241M) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G gamma-1 chain C region; IGHG1

UniProt

P01857

Expression Region

104-330aa (D239E, L241M)

Tag

Tag-Free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to bind Human FCGR3A in functional ELISA is less than 10 ug/ml.

Form

Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HOMER2 (1-343, His-tag) Human Protein
AR50307PU-N 250 µg

HOMER2 (1-343, His-tag) Human Protein

Sign In for Pricing
View Details
Porcine Pulmonary Vein Endothelial Primary Cells
CC11L95 5x 10^5 Cells/Vial

Porcine Pulmonary Vein Endothelial Primary Cells

Sign In for Pricing
View Details
Mouse histatin-5 (histatin-5) ELISA Kit
YP-W21699-01 48 Tests

Mouse histatin-5 (histatin-5) ELISA Kit

Sign In for Pricing
View Details
Mouse histatin-5 (histatin-5) ELISA Kit
YP-W21699-02 96 Tests

Mouse histatin-5 (histatin-5) ELISA Kit

Sign In for Pricing
View Details
Acetyl-Histone H4-K16 Rabbit pAb
E2505280 100 µL

Acetyl-Histone H4-K16 Rabbit pAb

Sign In for Pricing
View Details
Mouse IL36A ELISA Kit
E057472 1 Each

Mouse IL36A ELISA Kit

Sign In for Pricing
View Details