Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human IGHG1 protein

This Human IGHG1 protein spans the amino acid sequence from region 104-330aa (D239E, L241M) . Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

G gamma-1 chain C region; IGHG1

UniProt

P01857

Expression Region

104-330aa (D239E, L241M)

Tag

Tag-Free

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

The ED50 as determined by its ability to bind Human FCGR3A in functional ELISA is less than 10 ug/ml.

Form

Lyophilized powder

Molecular Weight

25.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

AA Sequence

DKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UCHL5IP (HAUS7) Mouse Monoclonal Antibody [Clone ID: LBI2E9]
AMM14132VCF 100 µg

UCHL5IP (HAUS7) Mouse Monoclonal Antibody [Clone ID: LBI2E9]

Sign In for Pricing
View Details
Ametryn-acetic acid
HY-163020 1 Each

Ametryn-acetic acid

Sign In for Pricing
View Details
Anti-NSE Rabbit pAb
GB11376-1-100 100 μL

Anti-NSE Rabbit pAb

Sign In for Pricing
View Details
Anti-HUG1 Antibody
CQA9686-01 30 µL

Anti-HUG1 Antibody

Sign In for Pricing
View Details
Anti-HUG1 Antibody
CQA9686-02 50 μL

Anti-HUG1 Antibody

Sign In for Pricing
View Details
Anti-HUG1 Antibody
CQA9686-03 100 µL

Anti-HUG1 Antibody

Sign In for Pricing
View Details