Human EFNA4 protein
This Human EFNA4 protein spans the amino acid sequence from region 26-171aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Ephrin-A4; EPH-Related Receptor Tyrosine Kinase Ligand 4; LERK-4; EFNA4; EPLG4; LERK4
UniProt
P52798
Expression Region
26-171aa
Tag
C-terminal 6xHis-Fc-tagged
Source
Mammalian cell
Origin
Homo sapiens (Human)
Field of Research
Cardiovascular Research
Endotoxin
Less than 1.0 EU/μg as determined by LAL method.
Purity
Greater than 95% as determined by SDS-PAGE.
Bioactivity
Measured by its binding ability in a functional ELISA. Immobilized Human EphA7-His at 2μg/ml can bind Human EFNA4-Fc-His, the ED50 of Recombinant Human EFNA4-Fc-His is 1.5190 ug/ml.
Form
Lyophilized powder
Molecular Weight
44.3 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
Partial
Preservative
Lyophilized from a 0.2 μm filtered PBS, pH 7.4.
AA Sequence
LRHVVYWNSSNPRLLRGDAVVELGLNDYLDIVCPHYEGPGPPEGPETFALYMVDWPGYESCQAEGPRAYKRWVCSLPFGHVQFSEKIQRFTPFSLGFEFLPGETYYYISVPTPESSGQCLRLQVSVCCKERKSESAHPVGSPGESG
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS7201589-01 48 Well
Human Fibronectin type III domain containing protein 1 (FNDC1) ELISA Kit
Sign In for Pricing
View Details MBS7201589-02 96 Well
Human Fibronectin type III domain containing protein 1 (FNDC1) ELISA Kit
Sign In for Pricing
View Details MBS7201589-03 5x 96 Well
Human Fibronectin type III domain containing protein 1 (FNDC1) ELISA Kit
Sign In for Pricing
View Details MBS7201589-04 10x 96 Well
Human Fibronectin type III domain containing protein 1 (FNDC1) ELISA Kit
Sign In for Pricing
View Details 
MBS6466122-01 0.1 mL
C-10 (MRP-1, Chemokine C-C motif ligand 6, CCL6) (MaxLight 405)
Sign In for Pricing
View Details