Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Mouse CTLA4 protein

This Mouse CTLA4 protein spans the amino acid sequence from region 37-161aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytotoxic T-lymphocyte protein 4; Cytotoxic T-lymphocyte-associated antigen 4; CTLA-4; CD152; Ctla4

UniProt

P09793

Expression Region

37-161aa

Tag

C-terminal 6xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Mouse B7-1-Fc at 5μg/ml can bind Mouse CTLA-4-His, the ED50 of Recombinant Mouse CTLA-4-His is 2-10 ng/ml.

Form

Lyophilized powder

Molecular Weight

14.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

Partial

Preservative

Lyophilized from a 0.2 μm filtered 1xPBS, pH 7.4

AA Sequence

AIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTVGFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPEPCPDSD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

C-Myb discontinued
347026-01 100 µL

C-Myb discontinued

Sign In for Pricing
View Details
C-Myb discontinued
347026-02 200 µL

C-Myb discontinued

Sign In for Pricing
View Details
L-Glutamine-15N2, d5
HY-N0390S7-01 5 mg

L-Glutamine-15N2, d5

Sign In for Pricing
View Details
L-Glutamine-15N2, d5
HY-N0390S7-02 10 mg

L-Glutamine-15N2, d5

Sign In for Pricing
View Details
L-Glutamine-15N2, d5
HY-N0390S7-03 25 mg

L-Glutamine-15N2, d5

Sign In for Pricing
View Details
L-Glutamine-15N2, d5
HY-N0390S7-04 50 mg

L-Glutamine-15N2, d5

Sign In for Pricing
View Details